DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and tmtops3a

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001269303.1 Gene:tmtops3a / 102031125 ZFINID:ZDB-GENE-130828-1 Length:379 Species:Danio rerio


Alignment Length:273 Identity:69/273 - (25%)
Similarity:136/273 - (49%) Gaps:19/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCT-NMPHYLINATVGYIVGGDLGCD 125
            ::|.....|..|:.:|:..:||.||.||::||:::.|:.:|. ..|....::..|..:.|..||.
Zfish    54 ILLLGCLNNLFVLLVFARFRSLWTPINLILLNISVSDILVCLFGTPFSFASSLYGKWLLGHHGCK 118

  Fly   126 IYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLS-YGQIVLLILFTWLWATPFSVLPLFQIW 189
            .|.....:.|:.:.::.:.::::||..:.......:| :.:..|.:..:||::..:: ||.|..|
Zfish   119 WYGFANSLFGIVSLMSLSILSYERYAALLRATKADVSDFRRAWLCVAGSWLYSLLWT-LPPFLGW 182

  Fly   190 GRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAK 254
            ..|.|||..||||..:...:..:..:|..:|::..::|:.:::..|.|:.        :|.:...
Zfish   183 SNYGPEGPGTTCSVQWHLRSTSSISYVMCLFIFCLLLPLVLMIFCYGKIL--------LLIKGVT 239

  Fly   255 KMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCL 319
            |:|:.:.....|        .|....:.:...::|.|.||.||||:..||...||||..|::|.:
Zfish   240 KINLLTAQRREN--------HILLMVVTMVSCYLLCWMPYGVVALLATFGRTGLITPVTSIVPSV 296

  Fly   320 ACKSVSCLDPWVY 332
            ..||.:.::|.:|
Zfish   297 LAKSSTVVNPVIY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 42/175 (24%)
7tm_1 69..332 CDD:278431 67/264 (25%)
tmtops3aNP_001269303.1 7tm_1 62..309 CDD:278431 67/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.