DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and tmtopsb

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001299608.1 Gene:tmtopsb / 100334480 ZFINID:ZDB-GENE-091118-50 Length:448 Species:Danio rerio


Alignment Length:334 Identity:87/334 - (26%)
Similarity:157/334 - (47%) Gaps:52/334 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPSGPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYHAGFYIAFIVLMLSSIFG 69
            |..|..|:::::..|.|:.|.||                            .:..:.|.....||
Zfish    67 GGEGTGAHLDENHSDHSLSPTGH----------------------------LVVAVCLGFIGTFG 103

  Fly    70 ---NGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCT-NMPHYLINATVGYIVGGDLGCDIYALN 130
               |.||:.:|...|.||:|.|.|::::::.||.:|. ..|.....:|.|..:.|..||..|...
Zfish   104 FLNNTLVLVLFCRYKVLRSPMNCLLISISVSDLLVCVLGTPFSFAASTQGRWLIGRAGCVWYGFI 168

  Fly   131 GGISGMGASITNAFIAFDRYKTI--SNPIDGRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQ 193
            ....|:.:.|:.|.::::||.|:  |...|. .:|.::|:.|.|:|:::..:::.|||. |..|.
Zfish   169 NSFLGVVSLISLAVLSYERYCTMMGSTQADS-TNYRKVVIGIAFSWIYSMVWTLPPLFG-WSCYG 231

  Fly   194 PEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNV 258
            |||..||||.::...|..|..::..:||:..::|..:|:.||.:|...:        .|..::| 
Zfish   232 PEGPGTTCSVNWAARTPNNVSYIVCLFVFCLILPFIVIVYSYGRLLQAI--------TQVSRIN- 287

  Fly   259 KSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKS 323
                   ...:...|.|:....:.:.:.::|.|.||.::||:..||...|:||..|::|.|..||
Zfish   288 -------TVVSRKREQRVLFMVVTMVVCYLLCWLPYGIMALLATFGHPGLVTPAASIVPSLLAKS 345

  Fly   324 VSCLDPWVY 332
            .:.::|.:|
Zfish   346 STVINPIIY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 55/181 (30%)
7tm_1 69..332 CDD:278431 76/268 (28%)
tmtopsbNP_001299608.1 7tm_4 98..>171 CDD:304433 22/72 (31%)
7tm_1 107..354 CDD:278431 75/264 (28%)
DUF2975 250..>331 CDD:288088 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.