DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and tmtops2b

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001269302.1 Gene:tmtops2b / 100331536 ZFINID:ZDB-GENE-110411-43 Length:368 Species:Danio rerio


Alignment Length:299 Identity:77/299 - (25%)
Similarity:142/299 - (47%) Gaps:37/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AGF-----YIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCTNMPHYLINA 112
            |||     ::.||  |....|.|.:|:.:|...|:||||.|:|:||::|.|:.:|      :...
Zfish    25 AGFIALSVFLGFI--MTFGFFNNLVVLVLFCKFKTLRTPVNMLLLNISISDMLVC------MFGT 81

  Fly   113 TVGYIVG-------GDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYGQIVLLI 170
            |:.:...       |..||..|.......|:.:.|:...:::|||.|::........|.:.:|.:
Zfish    82 TLSFASSVRGRWLLGRHGCMWYGFINSCFGIVSLISLVVLSYDRYSTLTVYHKRAPDYRKPLLAV 146

  Fly   171 LFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSY 235
            ..:||::..::|.||.. |..|..||..|:||..:...|.|:..::..:||:...:|:.:::..|
Zfish   147 GGSWLYSLIWTVPPLLG-WSSYGLEGAGTSCSVSWTQRTAESHAYIICLFVFCLGLPVLVMVYCY 210

  Fly   236 YKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALI 300
            .:|...|:...|:....|:|.                |..:....:...:.::|.|.||.|||::
Zfish   211 GRLLYAVKQVGKIRKTAARKR----------------EYHVLFMVITTVVCYLLCWMPYGVVAMM 259

  Fly   301 GCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKY 339
            ..||...:|:|..|::|.|..||.:.::|.:|...:.::
Zfish   260 ATFGRPGIISPVASVVPSLLAKSSTVINPLIYILMNKQF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 48/182 (26%)
7tm_1 69..332 CDD:278431 69/269 (26%)
tmtops2bNP_001269302.1 7tm_4 36..>78 CDD:304433 19/49 (39%)
7tm_1 45..291 CDD:278431 69/268 (26%)
ALDH-SF 215..>288 CDD:299846 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.