DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn8a

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001303876.1 Gene:opn8a / 100002138 ZFINID:ZDB-GENE-151029-1 Length:335 Species:Danio rerio


Alignment Length:308 Identity:88/308 - (28%)
Similarity:147/308 - (47%) Gaps:33/308 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YHAGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCTNM-PHYLINATV 114
            |.||.::  :|:.:.||.||..|:...:...|:.....||.:|||:.|:.|..:| |..:.:|..
Zfish    14 YSAGTFL--LVIAILSILGNAAVLLTAAWRHSVLKAPELLTVNLAVTDIGMALSMYPLSIASAFN 76

  Fly   115 GYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYGQ--IVLLILFTWLWA 177
            ...:|||..|..|.|.|.|..:.:.:|.|.:...||....||......:.:  |.:||...|:::
Zfish    77 HAWIGGDPSCLYYGLMGMIFSVASIMTLAVMGLVRYLVTGNPPKSGSKFRRKTISILIGVIWMYS 141

  Fly   178 TPFSVLPLFQIWGRYQPEGFLTTCSFDYL--TNTDENRLFVRTIFVWSYVIPMTMILVSY----Y 236
            ..::|.|:.. ||.|.||.|...||.|::  .::.....|:..:.:...::|..:||.||    :
Zfish   142 LLWAVFPILG-WGGYGPEPFGLACSVDWMGYQHSLNRSSFIMALAILCTLMPCVVILFSYSGIAW 205

  Fly   237 KLFTHVRVHEKMLAEQAKKMNVKSLSANANADNM-SVELRIAKAALIIYMLFILAWTPYSVVALI 300
            ||      |:.          .:|:.:|.|..|. :||.::....::|...||::|.||..|:|.
Zfish   206 KL------HKA----------YQSIQSNDNLPNSGAVERKVTLMGILISTGFIVSWAPYVFVSLW 254

  Fly   301 GCF---GEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELER 345
            ..|   ||..:: |.||:||||..|..:..:|.||......:|.|:.:
Zfish   255 TMFRSEGEDSVV-PIVSLLPCLFAKCSTVYNPLVYYVFRKSFRREIHQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 52/184 (28%)
7tm_1 69..332 CDD:278431 78/275 (28%)
opn8aNP_001303876.1 7tm_4 21..>219 CDD:304433 57/214 (27%)
7tm_1 30..288 CDD:278431 78/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.