DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and PAS2

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001190277.1 Gene:PAS2 / 830912 AraportID:AT5G10480 Length:230 Species:Arabidopsis thaliana


Alignment Length:224 Identity:64/224 - (28%)
Similarity:117/224 - (52%) Gaps:15/224 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVIIFQNAAFVEILNA 83
            |.|.::||..||.....||:.:|:..:......|.|     .:::.....:.:.|.||.:|||:.
plant     6 SVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYE-----NVYDAIEKPLQLAQTAAVLEILHG 65

  Fly    84 SFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAIT---------EIIRYGY 139
            ..|||:|....|..|:.||:.:..|::.:.|..:....:...:::|:||         |||||.:
plant    66 LVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEFPITTWIVEIIRYSF 130

  Fly   140 YAL-NIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYF 203
            :.. ..:...|.:.::|||::|::|||.|:|.|:...:.|..:.:.:.::||.|||..|.:|.:|
plant   131 FGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILNFSFDFF 195

  Fly   204 GFLWIVMLGYIPIFPQLYLHMFAQRRKIL 232
            ....:|:..|:|..|.:|.:|..||::.|
plant   196 YATILVLAIYVPGSPHMYRYMLGQRKRAL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 52/168 (31%)
PAS2NP_001190277.1 PLN02838 1..230 CDD:166479 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23409
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54207
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 1 1.000 - - FOG0001899
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101538
Panther 1 1.100 - - LDO PTHR11035
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1253
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.