DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and Hacd4

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001364027.1 Gene:Hacd4 / 66775 MGIID:1914025 Length:232 Species:Mus musculus


Alignment Length:217 Identity:49/217 - (22%)
Similarity:104/217 - (47%) Gaps:6/217 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVIIFQNAAFVEIL 81
            :|.....:|||.|...|..|.|:||..:...:...|.:..|..  :....|.:.:.|:.:.:|:|
Mouse    11 QPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADT--FYAIGLVMRVCQSISLLELL 73

  Fly    82 NASFGLVKSNPVVTGF-QVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYYALNIV 145
            :...| ::||.:...| |:..|::::.||:.:....:....:.:..:.|.:.:::||.|..|:::
Mouse    74 HIYIG-IESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVI 137

  Fly   146 KVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYFGFLWIVM 210
            ......:.:|..|.::.:||:.|..|....:.:..|.......|.|:|...:..|.|...|:::|
Mouse   138 GTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMM 202

  Fly   211 LGYIPIFPQLYLHMFAQRRKIL 232
            | :|.:: ..|.|::.:|:..|
Mouse   203 L-FIGMY-FTYSHLYTERKDFL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 35/159 (22%)
Hacd4NP_001364027.1 PTPLA 65..223 CDD:398198 36/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.