DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and HACD3

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_057479.2 Gene:HACD3 / 51495 HGNCID:24175 Length:362 Species:Homo sapiens


Alignment Length:259 Identity:70/259 - (27%)
Similarity:117/259 - (45%) Gaps:36/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKAVSKSSKPGASKE--PSAVTKL---YLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVT 60
            :.||...:.:|.....|  |..:|.|   |||.||..|.:|:|:|...|...:.:.|.|     :
Human   120 LRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKE-----S 179

  Fly    61 LWE--YTRLAVIIF-QNAAFVEILNASFGLVKSNPVVTGFQVFSR---MMVVVGVVMATPTGKVS 119
            .::  :|...::.| |..|.||.:||:.|:..|..:.:..|:..|   :.::.|.:.......| 
Human   180 FYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAV- 243

  Fly   120 PGLPIALLAWAITEIIRYGYYALNIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARE 184
              :......|:..||.||.:|.|..:.:....:.:||||.:|.|||:|...|.:....:.....|
Human   244 --VFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNE 306

  Fly   185 NSVWSVVMPN--KWNATFSYFGFLWIVMLGYIPIFPQLYL---HMFAQRRKILGGGSSGSPQKK 243
            ...:|..:|.  |....||:|..::::|     ||..||:   |::.|||:..|       |||
Human   307 TGRFSFTLPYPVKIKVRFSFFLQIYLIM-----IFLGLYINFRHLYKQRRRRYG-------QKK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 45/166 (27%)
HACD3NP_057479.2 p23_hB-ind1_like 8..115 CDD:107222
PTPLA 195..355 CDD:309504 45/167 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.