DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and HACD4

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001308832.1 Gene:HACD4 / 401494 HGNCID:20920 Length:283 Species:Homo sapiens


Alignment Length:270 Identity:54/270 - (20%)
Similarity:112/270 - (41%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVIIFQNAAFVEIL 81
            :|......|||.|...|..|.|:|...:...:...|.:  :.|..:....|.:.:.|:.:.:|:|
Human    11 QPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKD--SMVDTFYAIGLVMRLCQSVSLLELL 73

  Fly    82 NASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALL--AWAITEIIRYGYYALNI 144
            :...| ::||.::..|...:..::::.||: |...:|.....:.:|  .|.:.:::||.|..|::
Human    74 HIYVG-IESNHLLPRFLQLTERIIILFVVI-TSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSV 136

  Fly   145 VKVVPHFVVFLRYTTFIVLYPIGVTGE-------------------------------------- 171
            :.:....:.:|..|.::.:||:.|..|                                      
Human   137 IGISYAVLTWLSQTLWMPIYPLCVLAEEAKLKREAALHSRQNTGQKATASEAFTSLTHCMKPSSC 201

  Fly   172 ---------LLCFWWA--QS--YARENSVWSVVMPNKWNATFSYFGFLWIVMLGYIPIFPQLYLH 223
                     :|.:.:|  ||  |......:|..:|...:..|.|...::::|| :|.:: ..|.|
Human   202 RKISSGLPLILHYAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMML-FIGMY-FTYSH 264

  Fly   224 MFAQRRKILG 233
            ::::||.|||
Human   265 LYSERRDILG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 39/211 (18%)
HACD4NP_001308832.1 PTPLA 65..273 CDD:282269 39/211 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.