Sequence 1: | NP_609534.1 | Gene: | Hacd1 / 34614 | FlyBaseID: | FBgn0032394 | Length: | 245 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001308832.1 | Gene: | HACD4 / 401494 | HGNCID: | 20920 | Length: | 283 | Species: | Homo sapiens |
Alignment Length: | 270 | Identity: | 54/270 - (20%) |
---|---|---|---|
Similarity: | 112/270 - (41%) | Gaps: | 59/270 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 EPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVIIFQNAAFVEIL 81
Fly 82 NASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALL--AWAITEIIRYGYYALNI 144
Fly 145 VKVVPHFVVFLRYTTFIVLYPIGVTGE-------------------------------------- 171
Fly 172 ---------LLCFWWA--QS--YARENSVWSVVMPNKWNATFSYFGFLWIVMLGYIPIFPQLYLH 223
Fly 224 MFAQRRKILG 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hacd1 | NP_609534.1 | PTPLA | 73..232 | CDD:282269 | 39/211 (18%) |
HACD4 | NP_001308832.1 | PTPLA | 65..273 | CDD:282269 | 39/211 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5198 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1458293at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |