DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and hacd3

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001038449.1 Gene:hacd3 / 393441 ZFINID:ZDB-GENE-040426-1200 Length:359 Species:Danio rerio


Alignment Length:238 Identity:64/238 - (26%)
Similarity:113/238 - (47%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEP-SAVTKLYLFAYNAGQVVGWSYILWQL-VNYYILQGPEFRAQVTLWE--YTRLAVIIF-QNA 75
            |:| ..:.|.:||.||..|.:|:|:|...: |..:||      .|.:.::  :|...|:.| |..
Zfish   136 KDPFLGLKKGFLFMYNLVQFLGYSWIFVNMTVRLFIL------GQDSFYDTFHTIADVMYFCQML 194

  Fly    76 AFVEILNASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYY 140
            |.:|::|.:.||||:..:....||..|..::..:..:....:..|.:......|:..||.||.:|
Zfish   195 AIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFY 259

  Fly   141 ALNIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYFGF 205
            .|..:......:.:||||.::.|||:||..|.:....:.....|..:.|:.:|   .||.....|
Zfish   260 MLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLP---KATGLSLSF 321

  Fly   206 LWIVMLGYIPIFPQLYL---HMFAQRRKILGGGSSGSPQKKAN 245
            .:|:.|..:.:|..|::   |:|.||.:     ...:.::|||
Zfish   322 SYILQLYLVVMFLGLFINFRHLFKQRTR-----RFRTKKRKAN 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 43/161 (27%)
hacd3NP_001038449.1 p23_hB-ind1_like 6..113 CDD:107222
PTPLA 192..346 CDD:282269 41/156 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.