DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and Hacd2

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster


Alignment Length:234 Identity:70/234 - (29%)
Similarity:109/234 - (46%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GASKEPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRL--AVIIFQNA 75
            |..||.:  .|:|:..||....||:.||:..:...|...|.:...:.    |..:  |....|..
  Fly   141 GYIKEKT--KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKT----YANVGNAFKFIQLL 199

  Fly    76 AFVEILNASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYY 140
            .::|:::..||..|.:|||..|||..|..::..::...|.....|.:....:.|::.|::||.||
  Fly   200 QYLEVMHPMFGYTKGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYY 264

  Fly   141 ALNIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYFGF 205
            ...::......:.:||||.:|.|||:|:..|.:.......|..|...::|.|||.||.||....|
  Fly   265 LAQLLGREVGLLTWLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLF 329

  Fly   206 LWIVMLGYIPIFPQLYL---HMFAQRRKILGGGSSGSPQ 241
            |.|.::  :.|.|..||   ||...|.|.||.|.:...|
  Fly   330 LKIYLM--LLIIPGSYLVMSHMAKLRSKKLGKGRAKRQQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 51/161 (32%)
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 51/161 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456185
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.