DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and hpo-8

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_504740.2 Gene:hpo-8 / 188513 WormBaseID:WBGene00020517 Length:218 Species:Caenorhabditis elegans


Alignment Length:217 Identity:94/217 - (43%)
Similarity:139/217 - (64%) Gaps:13/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YLFAYNAGQVVGWSYILWQ----LVNYYILQGPEFRAQVTLWEYTRLAVIIFQNAAFVEILNASF 85
            ||.|||..|::|||.||.:    |.|.  |..|:      |:|.....:.|||.||.:|:::|..
 Worm     6 YLVAYNVLQILGWSAILVKTVLGLANG--LTWPQ------LYESVEFELKIFQTAAILEVIHAIV 62

  Fly    86 GLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYYALNIVK-VVP 149
            |||:|....|..||.||:::|..::....|.:.|.|:|:.|:||::||:|||.:|||:::| .:|
 Worm    63 GLVRSPVGTTAMQVTSRVVLVWPILHLCSTARFSIGVPLLLVAWSVTEVIRYSFYALSVLKQPIP 127

  Fly   150 HFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYFGFLWIVMLGYI 214
            :|:::||||.|.||||:||:||||..:.:.:...|..:.::.|||:.|...|::..|.|..|.||
 Worm   128 YFLLYLRYTLFYVLYPMGVSGELLTLFASLNEVDEKKILTLEMPNRLNMGISFWWVLIIAALSYI 192

  Fly   215 PIFPQLYLHMFAQRRKILGGGS 236
            |.|||||.:|..||:|||||||
 Worm   193 PGFPQLYFYMIGQRKKILGGGS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 69/159 (43%)
hpo-8NP_504740.2 PTPLA 50..210 CDD:282269 69/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162183
Domainoid 1 1.000 145 1.000 Domainoid score I2834
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23409
Inparanoid 1 1.050 170 1.000 Inparanoid score I2760
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54207
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 1 1.000 - - FOG0001899
OrthoInspector 1 1.000 - - oto17715
orthoMCL 1 0.900 - - OOG6_101538
Panther 1 1.100 - - LDO PTHR11035
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R545
SonicParanoid 1 1.000 - - X1253
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.