DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and R10E4.9

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_497864.1 Gene:R10E4.9 / 187773 WormBaseID:WBGene00011205 Length:202 Species:Caenorhabditis elegans


Alignment Length:218 Identity:57/218 - (26%)
Similarity:91/218 - (41%) Gaps:35/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYLFAYNAGQVVGWSYILWQLVNY---YILQG---PEFRAQVTLWEYTRLAVIIFQNAAFVEILN 82
            :.||.|        :.:|:.|..|   ||...   .||:....:|....:..:.:.:..|     
 Worm     7 MILFIY--------TLVLFILHGYGFLYIFHAEYTSEFKYPEIMWFLLFITSLQYLDIPF----- 58

  Fly    83 ASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYYALNIVKV 147
             ||.|.|||||....||..|:: |:.|.....:.|.:....:|:  :.::|:.|..||..|.:..
 Worm    59 -SFFLTKSNPVAVFVQVSGRLL-VLWVASHMVSWKYAAFSLVAV--YLLSELCRGPYYLSNCLGT 119

  Fly   148 VPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYFGFLWIVMLG 212
            ....:.:|||..|.||||:|.|.|.|.|         .:|:.|......:....||.:..:..:.
 Worm   120 PNRSLTWLRYNAFKVLYPVGFTCEALVF---------INVFFVSGKIPIDIKDRYFQYSLLFTVF 175

  Fly   213 YIPIFPQLYLHM---FAQRRKIL 232
            ::.|...||..|   .||:.|.|
 Worm   176 FLTIVTFLYRSMSRKAAQKNKTL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 45/161 (28%)
R10E4.9NP_497864.1 PTPLA 50..>148 CDD:295197 34/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54207
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.