DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and Hacd2

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_038944841.1 Gene:Hacd2 / 102551408 RGDID:1306337 Length:254 Species:Rattus norvegicus


Alignment Length:244 Identity:94/244 - (38%)
Similarity:139/244 - (56%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAKAVSK-----SSKPGA--------SKEPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGP 53
            :|.|.:|     |.:.||        .|.|..|...||..||.....||..|...||..|:.:| 
  Rat     5 AATATTKGNGGGSGRAGAGDSSGSRKKKGPGPVATAYLVIYNVVMTAGWLVIAVGLVRAYLAKG- 68

  Fly    54 EFRAQVTLWEYTRLAVIIFQNAAFVEILNASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKV 118
               :..:|:......:..||..|.:|||:.:.|:|.|:.|:|.|||.||:.::..|..:....:.
  Rat    69 ---SYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQS 130

  Fly   119 SPGLPIALLAWAITEIIRYGYYALNIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYAR 183
            ...:.:.::||.|||||||.:|..:::..:|:.:.:.|||.||||||:|||||||..:.|..|.|
  Rat   131 EDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVTGELLTIYAALPYVR 195

  Fly   184 ENSVWSVVMPNKWNATFSYFGFLWIVMLGYIPIFPQLYLHMFAQRRKIL 232
            :..::|:.:|||:|.:|.|..||.:||:.|||:|||||.||..||||:|
  Rat   196 QAGLYSISLPNKYNFSFDYHAFLILVMISYIPLFPQLYFHMIQQRRKVL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 71/158 (45%)
Hacd2XP_038944841.1 PTPLA 85..245 CDD:398198 72/160 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4090
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3961
OMA 1 1.010 - - QHG54207
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 1 1.000 - - FOG0001899
OrthoInspector 1 1.000 - - otm45241
orthoMCL 1 0.900 - - OOG6_101538
Panther 1 1.100 - - LDO PTHR11035
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1253
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.