DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and hacd4

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_017953281.1 Gene:hacd4 / 100490902 XenbaseID:XB-GENE-995575 Length:224 Species:Xenopus tropicalis


Alignment Length:203 Identity:45/203 - (22%)
Similarity:87/203 - (42%) Gaps:20/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVII--FQNAAFVEILNASF 85
            |.||..|...|..|.|:|...:...::..|.:..|..    :..:.:::  .|..:.:|:.:...
 Frog     8 KTYLSIYYLLQFCGHSWIFTNMTARFLFFGQDAFADT----FYSIGLVMQGCQLLSVLELAHILL 68

  Fly    86 GLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIAL-LAWAITEIIRYGYYALNIVKVVP 149
            |:.:.:.:.|.|||..| ::::.||:.:.....|..:..|| ..|.:.::|||.|..|..|.:..
 Frog    69 GVEQYSLLPTFFQVTER-LIILFVVITSQEEVQSKYIVCALFFLWNLWDVIRYPYDMLAAVGIDY 132

  Fly   150 HFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYFGFLWIVMLGYI 214
            ..:..|::|.:|:.||:.|..|....:.:..|......:|..|.:..:.:|            :.
 Frog   133 SALTRLKHTWWILAYPLSVLAEAYTVYESLPYFESRGTYSFKMESPVSLSF------------HF 185

  Fly   215 PIFPQLYL 222
            |....|||
 Frog   186 PYILTLYL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 35/151 (23%)
hacd4XP_017953281.1 PTPLA 56..217 CDD:398198 35/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.