DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd1 and hacd1

DIOPT Version :9

Sequence 1:NP_609534.1 Gene:Hacd1 / 34614 FlyBaseID:FBgn0032394 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002939049.2 Gene:hacd1 / 100145048 XenbaseID:XB-GENE-957000 Length:240 Species:Xenopus tropicalis


Alignment Length:228 Identity:80/228 - (35%)
Similarity:130/228 - (57%) Gaps:4/228 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SKSSKPGASKEPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVII 71
            |...|....|:...:...:|..||.....||..:...::.:|..:|    ....|:...:..:..
 Frog     9 SVEEKEHTKKKIGPLATAWLTFYNIAMTAGWLVLAIAMIRFYAEKG----THKGLYRNIQKTLKF 69

  Fly    72 FQNAAFVEILNASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIR 136
            ||..|.:|:::.:.|:|.::.:|||.||.||:.:|..:..:....:...|:.|.|:.|.:|||.|
 Frog    70 FQTFALLELVHCALGIVHTSVLVTGVQVSSRIFMVWFITSSIKQVQSEHGVLIFLVVWTVTEITR 134

  Fly   137 YGYYALNIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFS 201
            |.||...::..:|:|:.:.||..||||||:||.||||..:.|..:.|:::::|:.:|||:|.:|.
 Frog   135 YSYYTFKLLNHLPYFIKWARYNLFIVLYPVGVVGELLTIYAALPHVRKSAMYSLRLPNKYNVSFD 199

  Fly   202 YFGFLWIVMLGYIPIFPQLYLHMFAQRRKILGG 234
            |:.||.|.|..|||:|||||.||..|||::|.|
 Frog   200 YYYFLIIAMCSYIPLFPQLYFHMLRQRRRVLHG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd1NP_609534.1 PTPLA 73..232 CDD:282269 66/158 (42%)
hacd1XP_002939049.2 PTPLA 71..230 CDD:367918 66/158 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4434
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4051
OMA 1 1.010 - - QHG54207
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 1 1.000 - - FOG0001899
OrthoInspector 1 1.000 - - otm48304
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R545
SonicParanoid 1 1.000 - - X1253
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.