DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nfs1 and Scly

DIOPT Version :9

Sequence 1:NP_609533.1 Gene:Nfs1 / 34613 FlyBaseID:FBgn0032393 Length:462 Species:Drosophila melanogaster
Sequence 2:XP_008765499.1 Gene:Scly / 363285 RGDID:1359514 Length:458 Species:Rattus norvegicus


Alignment Length:383 Identity:127/383 - (33%)
Similarity:192/383 - (50%) Gaps:59/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ETESAVEKAREQVATLIGADPKEIIFTSGATESNNIAVKGVARFY------------------GT 149
            :.:..:..||..:|.:||..|::||||||.|||||:.:....|.:                  ||
  Rat    84 KAKDIINTARASLAKMIGGKPQDIIFTSGGTESNNLVIHSTVRCFHEQQTLQGRTVDQISPEEGT 148

  Fly   150 KKRHVITTQTEHKCVLDSCR-----ALENEGFKVTYLPV-LANGLIDLQQLEETITSETSLVSIM 208
            :. |.||...||    ||.|     .:|::..:||::|| ..||.::::.:...:...|.||:||
  Rat   149 RP-HFITCTVEH----DSIRLPLEHLVEDQVAEVTFVPVSKVNGQVEVEDILAAVRPTTCLVTIM 208

  Fly   209 TVNNEIGVRQPVDEIGKLCRS----------RRVFFHTDAAQAVGKVPLDVNAMNIDLMSISGHK 263
            ..|||.||..|:.||.:..::          .||..|||||||:||..:||..:.:|.::|.|||
  Rat   209 LANNETGVIMPISEISRRIKALNQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDFLTIVGHK 273

  Fly   264 IYGPKGVGALYVRRRPRVR-LEPIQSGGGQERGLRSGTVPAPLAVGLGAAAELSLREMD-YD--- 323
            .|||: :||||||...::. |.|:..||||||..|.||...|:..|||.||:|.....: |:   
  Rat   274 FYGPR-IGALYVRGVGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHM 337

  Fly   324 KKWVDFLSNRL------LDRISSALPHVIRNGDAKATYNGC-LNLSFAYVEGESLLMALKDVALS 381
            :...|:|..||      ...::|..|.|.|      ..|.| .::..:.:.|..:|...:.:..|
  Rat   338 RDIRDYLEERLEAEFGKRIHLNSRFPGVER------LPNTCNFSIQGSQLRGYMVLAQCQTLLAS 396

  Fly   382 SGSACTSASLE-PSYVLRAIGTDEDLAHSSIRFGIGRFTTVEEVDYTADKCIKHVERL 438
            .|::|.|...: ||.||.:.|...|:|.:::|..:||.||..|||.......:.|.:|
  Rat   397 VGASCHSDHEDRPSPVLLSCGIPVDVARNAVRLSVGRSTTRAEVDLIVQDLKQAVNQL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nfs1NP_609533.1 AAT_I 63..462 CDD:388495 127/383 (33%)
SclyXP_008765499.1 NifS 83..454 CDD:224029 126/381 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1104
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.