DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment escl and DAW1

DIOPT Version :9

Sequence 1:NP_001285857.1 Gene:escl / 34611 FlyBaseID:FBgn0032391 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_849143.1 Gene:DAW1 / 164781 HGNCID:26383 Length:415 Species:Homo sapiens


Alignment Length:467 Identity:97/467 - (20%)
Similarity:177/467 - (37%) Gaps:134/467 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSSVCNVVEPDDEHEVNSVDREDTASLFSTTTTTTRSKSPNTRKLNRLCRRIKAPKMVQPLYKYS 100
            |:.|..:||     |:...:...|||              .|.::..|.:|::     :.|.:.|
Human    38 STDVSALVE-----EIQKAEPLLTAS--------------RTEQVKLLIQRLQ-----EKLGQNS 78

  Fly   101 SH------VREDHNHQIFGVQFNPFLDRGQPQVFATVGKDRVSIYEC---ERSTGQE--SCEGIR 154
            :|      |.:.|...:..|..|.     ....|.|...||.    |   :.::|:|  :.||.|
Human    79 NHTFYLFKVLKAHILPLTNVALNK-----SGSCFITGSYDRT----CKLWDTASGEELNTLEGHR 134

  Fly   155 LLQVYADPDTDESFYTCAWSYDSVTGDPVLAAAGYRGVIRIFNPVKHQCSKNYIGHGHAINELKF 219
            .: ||            |.::::..||.: |...:....::::....:|...:.||...|..|.|
Human   135 NV-VY------------AIAFNNPYGDKI-ATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSF 185

  Fly   220 HPTRPQLLLSGSKDHSLRLWNIQSDVCVAVFGGVEGHRDEVLSVDFDLRGDRIMSSGMDHSLKLW 284
            :| :..|:.:||.|.:.:||:||:...|..   :.||..|::|:.|:..||||::...||::.:|
Human   186 NP-QSTLVATGSMDTTAKLWDIQNGEEVYT---LRGHSAEIISLSFNTSGDRIITGSFDHTVVVW 246

  Fly   285 RLDKPDIKEAIELSSGFSPNKNTGPFPTIKEHFPDFSTRDIHRNYVDCVQWFGDFVFSKSCENSI 349
            ..|           :|...|...|       |..:.|:...:        |....:.:.|.:.:.
Human   247 DAD-----------TGRKVNILIG-------HCAEISSASFN--------WDCSLILTGSMDKTC 285

  Fly   350 VCWKP--GK--LSESWHEIKPQESATTVLHHFDY---------------------KMC------- 382
            ..|..  ||  .:.:.|:.:..:|.      |||                     :.|       
Human   286 KLWDATNGKCVATLTGHDDEILDSC------FDYTGKLIATASADGTARIFSAATRKCIAKLEGH 344

  Fly   383 EIWFVRFAFNAWQKILALGNQLGTTFVWELDCNDPNLTKCSQLVHPKSNSTIRQTSFSKDGSILV 447
            |....:.:||.....|..|:...|..:|     |....:|.|::...::. |...:|:..|:|::
Human   345 EGEISKISFNPQGNHLLTGSSDKTARIW-----DAQTGQCLQVLEGHTDE-IFSCAFNYKGNIVI 403

  Fly   448 CVCDDST--VWR 457
            ....|:|  :||
Human   404 TGSKDNTCRIWR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esclNP_001285857.1 WD40 96..459 CDD:225201 86/407 (21%)
WD40 107..352 CDD:295369 55/249 (22%)
WD40 repeat 111..158 CDD:293791 12/51 (24%)
WD40 repeat 169..209 CDD:293791 5/39 (13%)
WD40 repeat 214..251 CDD:293791 13/36 (36%)
WD40 253..>459 CDD:295369 47/239 (20%)
WD40 repeat 261..323 CDD:293791 15/61 (25%)
WD40 repeat 330..378 CDD:293791 7/51 (14%)
WD40 repeat 386..426 CDD:293791 9/39 (23%)
WD40 repeat 434..458 CDD:293791 8/26 (31%)
DAW1NP_849143.1 eRF1 <22..>90 CDD:224420 15/75 (20%)
WD40 81..120 CDD:197651 9/47 (19%)
WD 1 90..129 10/47 (21%)
WD40 repeat 96..132 CDD:293791 9/44 (20%)
WD40 126..415 CDD:238121 71/344 (21%)
WD 2 132..174 9/55 (16%)
WD40 repeat 137..175 CDD:293791 7/50 (14%)
WD 3 175..214 15/39 (38%)
WD40 repeat 181..217 CDD:293791 12/39 (31%)
WD 4 217..256 14/49 (29%)
WD40 repeat 222..258 CDD:293791 12/46 (26%)
WD 5 259..298 8/53 (15%)
WD40 repeat 265..300 CDD:293791 6/42 (14%)
WD 6 301..340 6/44 (14%)
WD40 repeat 306..342 CDD:293791 5/41 (12%)
WD 7 343..384 10/45 (22%)
WD40 repeat 348..384 CDD:293791 9/40 (23%)
WD 8 386..415 6/29 (21%)
WD40 repeat 390..414 CDD:293791 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.