DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and PGS1

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011523789.1 Gene:PGS1 / 9489 HGNCID:30029 Length:646 Species:Homo sapiens


Alignment Length:193 Identity:35/193 - (18%)
Similarity:65/193 - (33%) Gaps:86/193 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PQVS--PCC----------------------NTHCS-LRNVAKIVE----QIDRAVYSIDLA-IY 112
            |||:  |||                      ::|.. |.:.|:..|    ||..|...:.:| :|
Human   153 PQVTSPPCCLCPEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFFELMKGQIRVAKRRVVMASLY 217

  Fly   113 TFTSLF---LADSIKRALQRGVIIRIISDGE----MVYSKGS---------------------QI 149
            ..|...   |.|.::..|::.:..:..|:.:    :.:::||                     ::
Human   218 LGTGPLEQELVDCLESTLEKSLQAKFPSNLKVSILLDFTRGSRGRKNSRTMLLPLLRRFPEQVRV 282

  Fly   150 SM--------LAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGS 204
            |:        |.:|.:|.|...|..|.|.|..:.|.                    |:::||:
Human   283 SLFHTPHLRGLLRLLIPERFNETIGLQHIKVYLFDN--------------------SVILSGA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 29/160 (18%)
PLDc_2 96..239 CDD:289836 26/150 (17%)
PGS1XP_011523789.1 PLDc_PGS1_euk_1 186..359 CDD:197233 29/160 (18%)
PLDc_2 203..355 CDD:289836 25/143 (17%)
PLDc_PGS1_euk_2 439..598 CDD:197235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.