DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and clsC

DIOPT Version :10

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_415564.2 Gene:clsC / 947321 ECOCYCID:G6551 Length:473 Species:Escherichia coli


Alignment Length:131 Identity:27/131 - (20%)
Similarity:47/131 - (35%) Gaps:33/131 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VSPCCNTH---CSLRNVAKIVEQI-------DRAVYSIDLAIYTF----TSLFLADSIKRALQRG 130
            |.|.|:.|   |.|..:.|.::..       :.|.:::|:..|.:    :...|..::..|.:||
E. coli     8 VLPLCSQHPGQCGLFPLEKSLDAFAARYRLAEMAEHTLDVQYYIWQDDMSGRLLFSALLAAAKRG 72

  Fly   131 VIIRIISDG-------------------EMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIID 176
            |.:|::.|.                   |:.........:|..||...........||||...:|
E. coli    73 VRVRLLLDDNNTPGLDDILRLLDSHPRIEVRLFNPFSFRLLRPLGYITDFSRLNRRMHNKSFTVD 137

  Fly   177 G 177
            |
E. coli   138 G 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:472788 24/124 (19%)
clsCNP_415564.2 PLDc_ymdC_like_1 24..184 CDD:197210 21/115 (18%)
PLDc_ymdC_like_2 250..469 CDD:197212
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.