DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and SPO14

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_012956.3 Gene:SPO14 / 853902 SGDID:S000001739 Length:1683 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:24/123 - (19%)
Similarity:55/123 - (44%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PIVSTISIAVSTVLASEVIWKLVQCSRSKREKASRVHEVIIFNELGEICAAVHMRNSSMGSQKPQ 79
            |:::..|...:..|.|..:::::      |||::  .|..|....|         |.|:|.::  
Yeast   909 PLLTPPSDLTAEELKSLPMFEIL------REKST--CETQILRSAG---------NWSLGLKE-- 954

  Fly    80 VSPCCNTHCSLRNV-AKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRII 136
                  |.||::|. .|::||.:..:| |:...:..::::....:...:...::.||:
Yeast   955 ------TECSIQNAYLKLIEQSEHFIY-IENQFFITSTVWNGTCVLNKIGDALVDRIV 1005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 10/51 (20%)
PLDc_2 96..239 CDD:289836 6/41 (15%)
SPO14NP_012956.3 PX_domain 300..>390 CDD:413376
PH_PLD 473..660 CDD:269956
PLN02866 <638..1165 CDD:215467 24/123 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.