DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and PLDP1

DIOPT Version :10

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001326709.1 Gene:PLDP1 / 820932 AraportID:AT3G16785 Length:1139 Species:Arabidopsis thaliana


Alignment Length:75 Identity:18/75 - (24%)
Similarity:35/75 - (46%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 QVSPCCNTHCS-LRNVAKI---VEQIDRAVYS-----IDLA---IYTFTSLFLA-----DSIKRA 126
            ||.|..:..|. :|:|::.   ..|::.:::|     ||.|   ||.....|::     |::|..
plant   731 QVGPRTSCRCQIIRSVSQWSAGTSQVEESIHSAYRSLIDKAEHFIYIENQFFISGLSGDDTVKNR 795

  Fly   127 LQRGVIIRII 136
            :...:..||:
plant   796 VLEALYKRIL 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:472788 15/67 (22%)
PLDP1NP_001326709.1 PLN02866 38..1139 CDD:215467 18/75 (24%)

Return to query results.
Submit another query.