DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and pld1b

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_021326023.1 Gene:pld1b / 572492 ZFINID:ZDB-GENE-070510-3 Length:1042 Species:Danio rerio


Alignment Length:225 Identity:42/225 - (18%)
Similarity:79/225 - (35%) Gaps:78/225 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SRVHEVIIFNELGEI---CAAVHMRNSSMGSQKPQVSPCCN--------THCSLRNVAKIVEQID 101
            |.:..|:.||....|   |:.:......||.|      ..|        ||..|.  .::|.:: 
Zfish   805 SAIQAVMHFNYRTMIRGDCSIISQLKKEMGDQ------WINYISFGGLRTHAELE--GRLVTEL- 860

  Fly   102 RAVYSIDLAIYTFTSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQISMLAQLGVPVRVPIT 164
                     ||..:.:.:||      ...|||  ..|:|..|:..:.|:::::.:          
Zfish   861 ---------IYVHSKMLIAD------DNTVIIGSANINDRSMLGKRDSEVAVIYE---------- 900

  Fly   165 TNLMHNKFCIIDGFE-RVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLT 228
              .:|....::||.| :.....|..:|:    |:.::           ||.|.:.. |...|.::
Zfish   901 --DIHTVKSVMDGQEYQAGPFGLSLRLE----CFRMI-----------LGANTDPS-IDVTDPIS 947

  Fly   229 ATFQAE------------FQRMWRAFAKTE 246
            ..|..|            :||::|....::
Zfish   948 DQFYKEVWMSTAARNATIYQRVFRCLPSSD 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 30/166 (18%)
PLDc_2 96..239 CDD:289836 28/157 (18%)
pld1bXP_021326023.1 PLN03008 67..1027 CDD:331186 42/225 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.