Sequence 1: | NP_609530.1 | Gene: | zuc / 34609 | FlyBaseID: | FBgn0261266 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326023.1 | Gene: | pld1b / 572492 | ZFINID: | ZDB-GENE-070510-3 | Length: | 1042 | Species: | Danio rerio |
Alignment Length: | 225 | Identity: | 42/225 - (18%) |
---|---|---|---|
Similarity: | 79/225 - (35%) | Gaps: | 78/225 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 SRVHEVIIFNELGEI---CAAVHMRNSSMGSQKPQVSPCCN--------THCSLRNVAKIVEQID 101
Fly 102 RAVYSIDLAIYTFTSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQISMLAQLGVPVRVPIT 164
Fly 165 TNLMHNKFCIIDGFE-RVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLT 228
Fly 229 ATFQAE------------FQRMWRAFAKTE 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zuc | NP_609530.1 | PLDc_SF | 87..239 | CDD:301585 | 30/166 (18%) |
PLDc_2 | 96..239 | CDD:289836 | 28/157 (18%) | ||
pld1b | XP_021326023.1 | PLN03008 | 67..1027 | CDD:331186 | 42/225 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1502 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |