DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and pld6

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001082883.1 Gene:pld6 / 567338 ZFINID:ZDB-GENE-030131-3825 Length:227 Species:Danio rerio


Alignment Length:242 Identity:68/242 - (28%)
Similarity:123/242 - (50%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IMKQIRDYPIVSTISI-AVSTVLASEVIWKLVQCSRSKREKASRVHEVIIFNELGEICAAVHMRN 70
            :.||:....::..:.: .|:.||..|  | |...:|..|:....:.||:.|.. .::|.. |:..
Zfish     3 VFKQMSFKELMKVLGLGTVAFVLGVE--W-LNWLTRRLRDSRGPLKEVLFFPS-PQVCVE-HLFT 62

  Fly    71 SSMGSQKPQVSPCCNTHCSL-----RNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRG 130
            |.      :..||.   |.|     .:.::::|.:..|..|:::.|::|:::.::.:|....:||
Zfish    63 SH------RSFPCA---CPLPHGIQTSFSRLLEHLLSARTSLEMCIFSFSNMEMSRAILLLHKRG 118

  Fly   131 VIIRIISDGEMVYSKGSQISMLAQLGVPVRVPITTNL-MHNKFCIIDGFERVEEIRLLRKLKFMR 194
            |::|:::|.:.:...||||..|.:.|:.||..:::.: ||:||.::||          |||    
Zfish   119 VVVRVVTDRDYMTITGSQIGALRKAGISVRHEMSSAVHMHHKFALVDG----------RKL---- 169

  Fly   195 PCYSIVISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRA 241
                  ||||:|||...:..|.||.|||.:.:|...||.||.::|.|
Zfish   170 ------ISGSLNWTLTAVQSNKENVIITEEPELVRPFQQEFLKLWEA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 48/157 (31%)
PLDc_2 96..239 CDD:289836 46/143 (32%)
pld6NP_001082883.1 PLDc_vPLD6_like 71..208 CDD:197268 48/156 (31%)
PLDc_2 84..208 CDD:289836 46/143 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591948
Domainoid 1 1.000 81 1.000 Domainoid score I8492
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5146
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489926at2759
OrthoFinder 1 1.000 - - FOG0006595
OrthoInspector 1 1.000 - - oto40600
orthoMCL 1 0.900 - - OOG6_103738
Panther 1 1.100 - - LDO PTHR43856
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4839
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.