DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and pld2

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_005165435.1 Gene:pld2 / 565743 ZFINID:ZDB-GENE-060216-4 Length:948 Species:Danio rerio


Alignment Length:172 Identity:31/172 - (18%)
Similarity:61/172 - (35%) Gaps:68/172 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQIS 150
            |.||..:::...      .:...||..:...:||      .|..||  ..|:|..|:.::.|:::
Zfish   750 CGLRTHSQLGSS------PVTELIYVHSKALIAD------DRCYIIGSANINDRSMLGTRDSELA 802

  Fly   151 MLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIR------------LLRKLKFMRPCYSIVISG 203
            :|                      ::..||:..:.            .|||     .|:|::: |
Zfish   803 VL----------------------VEDEERISSVMDGEEYQAGPLALALRK-----ECFSVLL-G 839

  Fly   204 SVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKT 245
            :.:..:|.:           ||.::..|   |..:|...|:|
Zfish   840 AKSDPSLDI-----------DDPISDHF---FNDVWNKVAQT 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 28/164 (17%)
PLDc_2 96..239 CDD:289836 25/156 (16%)
pld2XP_005165435.1 PX_PLD2 56..182 CDD:132830
PLN02866 81..939 CDD:215467 31/172 (18%)
PH_PLD 171..297 CDD:269956
PLDc_vPLD2_1 323..467 CDD:197301
PLDc_vPLD2_2 628..809 CDD:197303 15/92 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.