DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pld

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001137610.1 Gene:Pld / 35554 FlyBaseID:FBgn0286511 Length:1364 Species:Drosophila melanogaster


Alignment Length:154 Identity:35/154 - (22%)
Similarity:53/154 - (34%) Gaps:46/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQIRDYPIVSTI-----SIAVSTVLASEVI--WKLVQCSRSKREKASRVHEVIIFNELGEICAAV 66
            |..|.|.|:..:     .:..||.:|...|  |.....||.:....:|:.|..|.|.  |...:.
  Fly  1098 KPFRVYVIMPLLPGFEGDVGGSTGIAVRAITHWNYASISRGRTSILTRLQEAGIANP--ENYISF 1160

  Fly    67 H-MRNSSMGSQKPQVSPCCNTHCSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRG 130
            | :||.|..:..|                            |...||..:.|.:||      .|.
  Fly  1161 HSLRNHSFLNNTP----------------------------ITELIYVHSKLLIAD------DRV 1191

  Fly   131 VII--RIISDGEMVYSKGSQISML 152
            ||.  ..|:|..|:..:.|:|:.:
  Fly  1192 VICGSANINDRSMIGKRDSEIAAI 1215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 14/68 (21%)
PLDc_2 96..239 CDD:289836 14/59 (24%)
PldNP_001137610.1 PX_PLD 230..431 CDD:132805
PH_PLD 419..564 CDD:269956
PLDc_vPLD1_2_yPLD_like_1 590..734 CDD:197236
PLDc_vPLD1_2_yPLD_like_2 1032..1220 CDD:197239 35/154 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.