DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pgs1

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006247917.1 Gene:Pgs1 / 303698 RGDID:1305052 Length:553 Species:Rattus norvegicus


Alignment Length:175 Identity:38/175 - (21%)
Similarity:71/175 - (40%) Gaps:50/175 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PQVS--PCC----------------------NTHCS-LRNVAKIVE----QIDRAVYSIDLA-IY 112
            |||:  |||                      ::|.. |.:.|:..|    ||..|...:.:| :|
  Rat    60 PQVTSPPCCLCPEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFFELMKGQIKIAKRRVVMASLY 124

  Fly   113 TFTSLF---LADSIKRALQRGVIIRIISDGE----MVYSKGSQ---------ISMLAQLGVPVRV 161
            ..|...   |.|.::.:|::.:..:..||.:    :.:::||:         :.:|.:....|||
  Rat   125 LGTGPLEQELVDCLESSLEKSLQAKFPSDLKVSILLDFTRGSRGRKNSRTMLLPLLQRFPEHVRV 189

  Fly   162 PI--TTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGS 204
            .:  |.||......:|.  ||..|...|:.:|......::::||:
  Rat   190 SLFHTPNLRGLLRLLIP--ERFNETIGLQHIKVYLFDNNVILSGA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 32/142 (23%)
PLDc_2 96..239 CDD:289836 29/132 (22%)
Pgs1XP_006247917.1 PLDc_PGS1_euk_1 93..266 CDD:197233 32/142 (23%)
PLDc_PGS1_euk_2 346..505 CDD:197235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.