DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pld6

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_220517.1 Gene:Pld6 / 287366 RGDID:1311987 Length:222 Species:Rattus norvegicus


Alignment Length:226 Identity:60/226 - (26%)
Similarity:103/226 - (45%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LASEVI-----WKLVQCSRSKREKASRVHEVIIFNELGEICAAVHMRNSSMGSQKPQVSPCCNTH 87
            ||.|.:     | |:...|.:||        ::|......|....::...:........||...|
  Rat    18 LALEALPWLMRW-LLAGRRPRRE--------VLFFPSQVTCTEALLQAPGLPPGPSSGCPCSLPH 73

  Fly    88 CSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMVYSKGSQISML 152
             |..::::::..:..|..|::|.::.|:|..|..:::...||||.:|:|:|.:.:...||||.:|
  Rat    74 -SESSLSRLLRALLAARSSLELCLFAFSSPQLGRAVQLLHQRGVRVRVITDCDYMALNGSQIGLL 137

  Fly   153 AQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWE 217
            .:.|:.||.......||:||.|:|                    ..::|:||:|||...:..|.|
  Rat   138 RKAGIQVRHDQDLGYMHHKFAIVD--------------------KKVLITGSLNWTTQAIQNNRE 182

  Fly   218 NCIITADDKLTATFQAEFQRMWRAFAKTEGS 248
            |.:|..|.:....|..||:|:|..|..|:.|
  Rat   183 NVLIMEDTEYVRLFLEEFERIWEEFDPTKYS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 44/151 (29%)
PLDc_2 96..239 CDD:289836 42/142 (30%)
Pld6XP_220517.1 PLDc_vPLD6_like 93..204 CDD:197268 40/130 (31%)
PLDc_2 94..204 CDD:289836 40/129 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350275
Domainoid 1 1.000 76 1.000 Domainoid score I8766
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5080
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489926at2759
OrthoFinder 1 1.000 - - FOG0006595
OrthoInspector 1 1.000 - - oto95723
orthoMCL 1 0.900 - - OOG6_103738
Panther 1 1.100 - - LDO PTHR43856
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.