DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pld2

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038941178.1 Gene:Pld2 / 25097 RGDID:3350 Length:972 Species:Rattus norvegicus


Alignment Length:187 Identity:39/187 - (20%)
Similarity:74/187 - (39%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VHMRNSSMGSQ-KPQVSPC-CNTHCSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQ 128
            :|...::||:. :..:|.| ..||..|..            :.|...||..:.|.:||      .
  Rat   757 LHRLKAAMGTAWRDYMSICGLRTHGELGG------------HPISELIYIHSKLLIAD------D 803

  Fly   129 RGVII--RIISDGEMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLK 191
            |.|||  ..|:|..::..:.|::::|.:         .|.:..:   ::||.| .:..|....|:
  Rat   804 RTVIIGSANINDRSLLGKRDSELAILIE---------DTEMEPS---LMDGVE-YQAGRFALSLR 855

  Fly   192 FMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKTEGS 248
              :.|:|::: |:..|..|.|...      ..||         |.::|:..|:...:
  Rat   856 --KHCFSVIL-GANTWPDLDLRDP------VCDD---------FFQLWQETAENNAT 894

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 31/153 (20%)
PLDc_2 96..239 CDD:289836 29/144 (20%)
Pld2XP_038941178.1 PLN02866 67..957 CDD:215467 39/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.