powered by:
Protein Alignment zuc and Pld1
DIOPT Version :9
Sequence 1: | NP_609530.1 |
Gene: | zuc / 34609 |
FlyBaseID: | FBgn0261266 |
Length: | 253 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006232267.1 |
Gene: | Pld1 / 25096 |
RGDID: | 3349 |
Length: | 1074 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 17/69 - (24%) |
Similarity: | 31/69 - (44%) |
Gaps: | 14/69 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 CSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQIS 150
|.||..|::...: :...||..:.|.:|| ...||| ..|:|..|:..:.|:::
Rat 876 CGLRTHAELEGNL------VTELIYVHSKLLIAD------DNTVIIGSANINDRSMLGKRDSEMA 928
Fly 151 MLAQ 154
::.|
Rat 929 VIVQ 932
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1502 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.