DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pld1

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006232267.1 Gene:Pld1 / 25096 RGDID:3349 Length:1074 Species:Rattus norvegicus


Alignment Length:69 Identity:17/69 - (24%)
Similarity:31/69 - (44%) Gaps:14/69 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQIS 150
            |.||..|::...:      :...||..:.|.:||      ...|||  ..|:|..|:..:.|:::
  Rat   876 CGLRTHAELEGNL------VTELIYVHSKLLIAD------DNTVIIGSANINDRSMLGKRDSEMA 928

  Fly   151 MLAQ 154
            ::.|
  Rat   929 VIVQ 932

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 17/69 (25%)
PLDc_2 96..239 CDD:289836 13/61 (21%)
Pld1XP_006232267.1 PX_PLD1 78..209 CDD:132829
PLN02866 82..1059 CDD:215467 17/69 (25%)
PH_PLD 197..326 CDD:269956
PLDc_vPLD1_1 352..502 CDD:197300
PLDc_vPLD1_2 754..935 CDD:197302 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.