DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and PLD6

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_016879799.2 Gene:PLD6 / 201164 HGNCID:30447 Length:300 Species:Homo sapiens


Alignment Length:130 Identity:33/130 - (25%)
Similarity:65/130 - (50%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AVSTVLASEVIWKLVQCSRSKREKASRVHEVIIFNELGEICAAVHMRNSSMGSQKPQVSPCCNTH 87
            ||...|..|.:..:::..||:|.:..|  |.:.|........|:.....:..::.|:..||...|
Human    57 AVGLALTLEALPWVLRWLRSRRRRPRR--EALFFPSQVTCTEALLRAPGAELAELPEGCPCGLPH 119

  Fly    88 CSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMVYSKGSQISML 152
             ....:::::..:..|..|:||.::.|:|..|..:::...||||.:|:::|.:.:...||||.:|
Human   120 -GESALSRLLRALLAARASLDLCLFAFSSPQLGRAVQLLHQRGVRVRVVTDCDYMALNGSQIGLL 183

  Fly   153  152
            Human   184  183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 19/66 (29%)
PLDc_2 96..239 CDD:289836 18/57 (32%)
PLD6XP_016879799.2 PLDc_SF 139..>185 CDD:326546 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156344
Domainoid 1 1.000 82 1.000 Domainoid score I8469
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5095
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489926at2759
OrthoFinder 1 1.000 - - FOG0006595
OrthoInspector 1 1.000 - - oto88590
orthoMCL 1 0.900 - - OOG6_103738
Panther 1 1.100 - - LDO PTHR43856
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4839
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.