DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pld6

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001277212.1 Gene:Pld6 / 194908 MGIID:2687283 Length:221 Species:Mus musculus


Alignment Length:171 Identity:51/171 - (29%)
Similarity:86/171 - (50%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PQVSPCCNTHCSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMV 142
            |...||...| |..::::::..:..|..|::|.::.|:|..|..:::...||||.:|:|:|.:.:
Mouse    63 PSGCPCSLPH-SESSLSRLLRALLAARSSLELCLFAFSSPQLGRAVQLLHQRGVRVRVITDCDYM 126

  Fly   143 YSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGSVNW 207
            ...||||.:|.:.|:.||.......||:||.|:|                    ..::|:||:||
Mouse   127 ALNGSQIGLLRKAGIQVRHDQDLGYMHHKFAIVD--------------------KKVLITGSLNW 171

  Fly   208 TALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKTEGS 248
            |...:..|.||.:|..|.:....|..||:|:|..|..|:.|
Mouse   172 TTQAIQNNRENVLIMEDTEYVRLFLEEFERIWEEFDPTKYS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 44/151 (29%)
PLDc_2 96..239 CDD:289836 42/142 (30%)
Pld6NP_001277212.1 Required for mitochondrial localization 1..38
PLDc_vPLD6_like 92..203 CDD:197268 40/130 (31%)
PLDc_2 93..203 CDD:289836 40/129 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846743
Domainoid 1 1.000 76 1.000 Domainoid score I8974
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5159
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006595
OrthoInspector 1 1.000 - - oto92155
orthoMCL 1 0.900 - - OOG6_103738
Panther 1 1.100 - - LDO PTHR43856
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4839
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.