DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pld2

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001289404.1 Gene:Pld2 / 18806 MGIID:892877 Length:944 Species:Mus musculus


Alignment Length:201 Identity:41/201 - (20%)
Similarity:79/201 - (39%) Gaps:57/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FNELGEIC----AAVHMRNSSMGSQ-KPQVSPC-CNTHCSLRNVAKIVEQIDRAVYSIDLAIYTF 114
            |..|..:|    :.:|...::||:. :..:|.| ..||..|..            :.|...||..
Mouse   715 FFSLRTLCRGEHSILHRLKAAMGTAWRDYMSICGLRTHGELGG------------HPISELIYIH 767

  Fly   115 TSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDG 177
            :.:.:||      .|.|||  ..|:|..::..:.|::::|.:         .|.:..:   ::||
Mouse   768 SKMLIAD------DRTVIIGSANINDRSLLGKRDSELAILIK---------DTEMEPS---LMDG 814

  Fly   178 FERVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAF 242
            .| .:..|....|:  :.|:|::: |:..|..|.|...      ..||         |.::|:..
Mouse   815 VE-YQAGRFALSLR--KHCFSVIL-GANTWPDLDLRDP------VCDD---------FFQLWQET 860

  Fly   243 AKTEGS 248
            |:...:
Mouse   861 AENNAT 866

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 30/153 (20%)
PLDc_2 96..239 CDD:289836 28/144 (19%)
Pld2NP_001289404.1 PX_domain 62..192 CDD:295365
PLN02866 67..929 CDD:215467 41/201 (20%)
PH_PLD 180..309 CDD:269956
PLDc_SF 335..475 CDD:301585
PLDc_SF 614..806 CDD:301585 24/117 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.