Sequence 1: | NP_609530.1 | Gene: | zuc / 34609 | FlyBaseID: | FBgn0261266 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001289404.1 | Gene: | Pld2 / 18806 | MGIID: | 892877 | Length: | 944 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 79/201 - (39%) | Gaps: | 57/201 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 FNELGEIC----AAVHMRNSSMGSQ-KPQVSPC-CNTHCSLRNVAKIVEQIDRAVYSIDLAIYTF 114
Fly 115 TSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDG 177
Fly 178 FERVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAF 242
Fly 243 AKTEGS 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zuc | NP_609530.1 | PLDc_SF | 87..239 | CDD:301585 | 30/153 (20%) |
PLDc_2 | 96..239 | CDD:289836 | 28/144 (19%) | ||
Pld2 | NP_001289404.1 | PX_domain | 62..192 | CDD:295365 | |
PLN02866 | 67..929 | CDD:215467 | 41/201 (20%) | ||
PH_PLD | 180..309 | CDD:269956 | |||
PLDc_SF | 335..475 | CDD:301585 | |||
PLDc_SF | 614..806 | CDD:301585 | 24/117 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1502 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |