DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and Pld1

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001355596.1 Gene:Pld1 / 18805 MGIID:109585 Length:1074 Species:Mus musculus


Alignment Length:116 Identity:27/116 - (23%)
Similarity:48/116 - (41%) Gaps:29/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVII--RIISDGEMVYSKGSQIS 150
            |.||..|::...:      :...||..:.|.:||      ...|||  ..|:|..|:..:.|:::
Mouse   876 CGLRTHAELEGNL------VTELIYVHSKLLIAD------DNTVIIGSANINDRSMLGKRDSEMA 928

  Fly   151 MLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVI 201
            ::.|  ....||          .::||.| .:..|..|.|:.  .|:.:|:
Mouse   929 VIVQ--DTETVP----------SVMDGKE-YQAGRFARDLRL--ECFRLVL 964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 27/116 (23%)
PLDc_2 96..239 CDD:289836 23/108 (21%)
Pld1NP_001355596.1 PLN02866 82..1059 CDD:215467 27/116 (23%)
Catalytic 463..928 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.