DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zuc and pgs-1

DIOPT Version :9

Sequence 1:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_490666.2 Gene:pgs-1 / 171594 WormBaseID:WBGene00021677 Length:446 Species:Caenorhabditis elegans


Alignment Length:217 Identity:43/217 - (19%)
Similarity:83/217 - (38%) Gaps:69/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FNELGEICAAVHMRNSSMGSQKPQV--SPCCNTHCSL------RNVAKIVEQIDRAVYSIDLAIY 112
            |:|:..:.|     :||...:..|:  ||.|:.|..|      |.:.|  .:::|.:.....:..
 Worm   175 FHEIINVVA-----DSSFIVENEQLVPSPKCDVHPYLGSAHLYREMLK--TRVNRVIEKYKESRK 232

  Fly   113 TFTSLFLADS-IKRALQRGVI-------------------IRI-ISDGEMVYSKGSQISMLAQLG 156
            |.::...||: |...||.|::                   ::: ::.|...:.:..:.|:|.:..
 Worm   233 TSSNCMSADTWIYPVLQMGLLGIHQEFEFLQKLFSLKNPELKMTMASGYFNFIRDYEESILKEGD 297

  Fly   157 VPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIV---------ISGSVN------ 206
            ..:.: :|.:...|.|...:||.           |::.|.||.:         |:|.:|      
 Worm   298 YHLDI-LTASPFANGFFESNGFS-----------KYIPPLYSNISDQFLRKREINGRLNVKMFEY 350

  Fly   207 ----WT--ALGLGGNWENCIIT 222
                ||  |.||.....|.::|
 Worm   351 RREEWTFHAKGLWAEHNNQLMT 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zucNP_609530.1 PLDc_SF 87..239 CDD:301585 34/184 (18%)
PLDc_2 96..239 CDD:289836 30/169 (18%)
pgs-1NP_490666.2 PLDc_PGS1_euk_1 17..182 CDD:197233 2/6 (33%)
PLDc_PGS1_euk_2 242..417 CDD:197235 26/143 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.