DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6686 and AT3G14700

DIOPT Version :9

Sequence 1:NP_723700.1 Gene:CG6686 / 34608 FlyBaseID:FBgn0032388 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001319553.1 Gene:AT3G14700 / 820698 AraportID:AT3G14700 Length:204 Species:Arabidopsis thaliana


Alignment Length:178 Identity:54/178 - (30%)
Similarity:83/178 - (46%) Gaps:47/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   784 EDLEDRAI----------LDEEPDVGAGVANALRLALSKGYLEKEEKNRPSNTKMAHLQAKNYSI 838
            ||:.|:||          :..|.|||.|::.||.....:|..::|.|                  
plant    64 EDIVDKAIDNHSRVRGDGIMREADVGTGLSGALNRLREQGTFKEEGK------------------ 110

  Fly   839 EDKAAGEDEKVGRRDRFHFGPITDFKDKETFKPNVKLDYIDDNGRILNLKEAFRYLSHKFHGKGP 903
                     .||.:|..|    .|.:.|:.|| ::::..::..|||:..|||:|.|.|.||||||
plant   111 ---------VVGVKDNNH----EDDRFKDRFK-DIQIQRVNKWGRIMTEKEAYRSLCHGFHGKGP 161

  Fly   904 GKNKIEKRLKKMEQDGLMKTMSSTDTPLGTLTMLQQKQKETKTAYVVL 951
            ||.|.||:.||.|...  |.|.|::.   ::..:::....:||.|:||
plant   162 GKKKQEKQRKKHEDKS--KQMESSER---SVERIREIHAISKTPYIVL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6686NP_723700.1 SART-1 279..918 CDD:281354 46/143 (32%)
AT3G14700NP_001319553.1 SART-1 <35..162 CDD:397428 37/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003739
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.