DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6686 and prr12b

DIOPT Version :9

Sequence 1:NP_723700.1 Gene:CG6686 / 34608 FlyBaseID:FBgn0032388 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_686084.5 Gene:prr12b / 557848 ZFINID:ZDB-GENE-130625-2 Length:2656 Species:Danio rerio


Alignment Length:437 Identity:109/437 - (24%)
Similarity:188/437 - (43%) Gaps:116/437 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HKKD------KKNRHRSRSSERPRRVTEDEDVTLDLTD---DSSSRHRHHKHKKHKEHRHKHHKQ 65
            :|||      :|..||...:.|.:.:.:.:.|. .||.   :...|.:..:.::.||.|.:..|:
Zfish  2227 NKKDYVRVCSRKPWHRPSLTLRRQSLPKPQPVR-SLTPPRMERDDREKERERQREKEQREQREKE 2290

  Fly    66 KERERANEVISLEESDSDSFSFFSGSDCVEVPVQAQVQAQAKLRDARESSNRDKERDSGRDRELL 130
            |||||..|                               :.:.|:..|.|.|:||::..|:|||.
Zfish  2291 KEREREKE-------------------------------REREREQIEKSRREKEKEKERERELE 2324

  Fly   131 RERERERDRERERDRDREKEREREREKERLREREEREREREKERIREREKERLRERERERERERV 195
            :::|||:.:|||::::|||:||||||||:     :||:|||:||.||:|:|:.||:|:|:|||:.
Zfish  2325 KQKEREKQKEREKEKEREKQREREREKEK-----QREKERERERQREKEREKQREKEKEKEREKE 2384

  Fly   196 RELTAPPPPQISKHAEYESRREREIERERDARKRSGRERERERNRERSRSQSPASSSRKPATKER 260
            ::|      |..:..|...||...:||.|....:...|:..:|.|.|     |.....:|..|:|
Zfish  2385 KKL------QQRQTQEKLDRRPALVERGRVKEDKKVGEKRADRTRSR-----PVKVKAEPPPKKR 2438

  Fly   261 E------PSSRSFSPIPENGAGDVLSITETNKLRAKLGLKPLEVDSGPSKAGPPPGSSSQGEIKK 319
            :      |||......||..:.|.:|.......||...:....|:...|.|..|           
Zfish  2439 KKWLKEVPSSSDSDSSPEPPSDDEVSTRSGMNSRAMREMFRSYVEMLVSTALDP----------- 2492

  Fly   320 PHGEADLSSYKDEWGEFLHKPADNLKEKREAEKLREKLKQRKEKRF------------------- 365
                 |:....::..:.|:.|     ..|:.:.:..:.|:|..:|.                   
Zfish  2493 -----DMIQALEDTNDELYLP-----PMRKIDSILNEQKRRLLRRLNISVQHQEALHMFPQMTAD 2547

  Fly   366 -LEERLARIKTLGESDEETDNVSKWVDKNKRVVNEREEAMRKAKELE 411
             |:....::...||.            .|::.:|..:.::.|.::|:
Zfish  2548 PLDSGAVKVHLGGEG------------YNRKTLNRVKRSLPKQQDLK 2582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6686NP_723700.1 SART-1 279..918 CDD:281354 21/153 (14%)
prr12bXP_686084.5 DUF4211 2469..2574 CDD:290637 18/137 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.