DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crys and LOC5667565

DIOPT Version :10

Sequence 1:NP_476906.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_001688325.2 Gene:LOC5667565 / 5667565 VectorBaseID:AGAMI1_001760 Length:483 Species:Anopheles gambiae


Alignment Length:70 Identity:44/70 - (62%)
Similarity:58/70 - (82%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIV 133
            :|||..||||::|.:.|:||||:|.|:|.|.||:|.|.|||:|||||||:||||||.|:||||:|
Mosquito   373 DDYDPNPQYSYSYHIADALTGDNKEQQESRSGDVVTGSYSLVEPDGTRRVVEYTADPVNGFNAVV 437

  Fly   134 SKQRL 138
            .::.|
Mosquito   438 HREPL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrysNP_476906.1 Chitin_bind_4 77..129 CDD:459790 33/51 (65%)
LOC5667565XP_001688325.2 None

Return to query results.
Submit another query.