DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crys and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_476906.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:70 Identity:42/70 - (60%)
Similarity:58/70 - (82%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIV 133
            |:||..|||.|:|.|.|.||||:|.|.|:||||:|:|:||||:.||.:|||:||||.::||||:|
  Fly    54 EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVV 118

  Fly   134 SKQRL 138
            :::.|
  Fly   119 NREPL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrysNP_476906.1 Chitin_bind_4 77..129 CDD:459790 31/51 (61%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 31/51 (61%)

Return to query results.
Submit another query.