DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crys and Ccp84Ac

DIOPT Version :9

Sequence 1:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:220 Identity:71/220 - (32%)
Similarity:107/220 - (48%) Gaps:40/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KRTYLLLCLSLLTCNVANSAYLRPID-------LNQLAKSSNLQQQQQQQLRGALNRDDNNDDDD 59
            |...|:.|     |..|.||.|.|::       |.|..:..::..|:|.::.             
  Fly     4 KLVALVSC-----CLAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIH------------- 50

  Fly    60 ATTLAPNSNEDY--DTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122
                 |:.:|.|  |..|:|:|||||:|:|:||.|.|.|.||||:|:|:|||.:.||.||.|:||
  Fly    51 -----PHGHEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYT 110

  Fly   123 ADDVSGFNAIVSKQRLDEQQQQRLSASTSSRFNSLEELQTRLTAQAIAEAQSLVEAQQASQLQLE 187
            ||.|:||||:|.::.|.....:.::|:.....::        .|.|.|..:|.....||......
  Fly   111 ADSVNGFNAVVHREPLAHVHHKVVAAAPVQYHHA--------PAAAAAVIKSYASPSQAYVAPTY 167

  Fly   188 AQNRRESENQARNQAQQLMEQFQQQ 212
            |.....:...|.:||:|..|:..||
  Fly   168 AAPAYTAPAYATHQAEQPQEREHQQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 32/51 (63%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.