DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crys and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:141 Identity:48/141 - (34%)
Similarity:71/141 - (50%) Gaps:32/141 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VANSAYLRPIDLNQLAKSSNLQQQQQQQLRGALNRDDNNDDDDATTLAPNSN-EDYDTRPQYSFA 80
            ||.:|||:...:.|.|                           ...:.|..: |.:|..|:|:|.
  Fly  1122 VAATAYLKSAPVTQHA---------------------------VLKVVPEKHLEHFDAHPRYAFE 1159

  Fly    81 YDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQRLDEQQQQR 145
            |.|.|..|||:|.|:|:||||:|||:|||:||||..|.|:|.||..:||:|.|    ::.:.|.:
  Fly  1160 YAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV----INSRDQGK 1220

  Fly   146 LSASTSSRFNS 156
            :.|...:...|
  Fly  1221 IVAKRQTETKS 1231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 30/51 (59%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.