DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crys and Cpr76Bc

DIOPT Version :9

Sequence 1:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster


Alignment Length:201 Identity:60/201 - (29%)
Similarity:94/201 - (46%) Gaps:46/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NDDDDATTLAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIV 119
            ::||:....||:    |: ...|:|:|.|:|..|||.|.|.|.||||.|||.||::||||:.|.|
  Fly    39 DEDDETMEYAPH----YE-HQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTV 98

  Fly   120 EYTADDVSGFNAIV----------------SKQRLDEQQQQR------------LSASTSSRFNS 156
            .||||...||||||                |.|..|:..|.:            ||:........
  Fly    99 HYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIKPLKRP 163

  Fly   157 LEELQTRLTAQAIAEAQSLVEAQQASQLQLEAQNRRESENQARNQAQQLMEQFQQQVQ-----QQ 216
            :|:|     ..:..:..||:|.:..::::   |...:.:...|::.||..:.:.:|:.     :.
  Fly   164 IEDL-----THSHPKVPSLIEIKPHARIK---QVPMDMDPGIRDRLQQARDTYYKQIAAAHKLED 220

  Fly   217 EQQRLQ 222
            ..|:||
  Fly   221 YSQKLQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 30/51 (59%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.