Sequence 1: | NP_001285854.1 | Gene: | Crys / 34604 | FlyBaseID: | FBgn0005664 | Length: | 477 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097644.1 | Gene: | Cpr76Bc / 40122 | FlyBaseID: | FBgn0036880 | Length: | 424 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 60/201 - (29%) |
---|---|---|---|
Similarity: | 94/201 - (46%) | Gaps: | 46/201 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 NDDDDATTLAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIV 119
Fly 120 EYTADDVSGFNAIV----------------SKQRLDEQQQQR------------LSASTSSRFNS 156
Fly 157 LEELQTRLTAQAIAEAQSLVEAQQASQLQLEAQNRRESENQARNQAQQLMEQFQQQVQ-----QQ 216
Fly 217 EQQRLQ 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Crys | NP_001285854.1 | Chitin_bind_4 | 77..129 | CDD:278791 | 30/51 (59%) |
Cpr76Bc | NP_001097644.1 | Chitin_bind_4 | 56..108 | CDD:278791 | 30/51 (59%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12236 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |