powered by:
Protein Alignment Crys and Cpr64Ab
DIOPT Version :9
Sequence 1: | NP_001285854.1 |
Gene: | Crys / 34604 |
FlyBaseID: | FBgn0005664 |
Length: | 477 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647873.2 |
Gene: | Cpr64Ab / 38509 |
FlyBaseID: | FBgn0035511 |
Length: | 120 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 39/68 - (57%) |
Similarity: | 54/68 - (79%) |
Gaps: | 0/68 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 NEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAI 132
|.:.|..|||:|||:|:|:||||.|.|:|.||||:|||.||:::.||:.|.|.||||.::||||:
Fly 33 NTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAV 97
Fly 133 VSK 135
|.:
Fly 98 VQR 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1544103at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.920 |
|
Return to query results.
Submit another query.