DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crys and resilin

DIOPT Version :10

Sequence 1:NP_476906.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:55 Identity:25/55 - (45%)
Similarity:33/55 - (60%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTAD 124
            |.|...:|.|.|.|.|:.:|......|.||||...|||:::.|||.::||||.||
  Fly   338 DNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEAD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrysNP_476906.1 Chitin_bind_4 77..129 CDD:459790 23/48 (48%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790 23/48 (48%)

Return to query results.
Submit another query.