DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Crys and Cpr62Ba

DIOPT Version :10

Sequence 1:NP_476906.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_565358.4 Gene:Cpr62Ba / 3290246 VectorBaseID:AGAMI1_002953 Length:144 Species:Anopheles gambiae


Alignment Length:80 Identity:26/80 - (32%)
Similarity:34/80 - (42%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNA 131
            ||...:....|||.|.:....:|......|.|.||.|.|.|.::||.|..|.|.|..|..|||..
Mosquito    37 SNYQQNAEIDYSFRYYIDHPPSGVSFDHWENRKGDHVHGGYGVLEPGGFVRTVHYEVDGDSGFRT 101

  Fly   132 IVSKQRLDEQQQQRL 146
            ::........||..:
Mosquito   102 VIKTTAPGSSQQYNI 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrysNP_476906.1 Chitin_bind_4 77..129 CDD:459790 20/51 (39%)
Cpr62BaXP_565358.4 None

Return to query results.
Submit another query.