DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or98b

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:332 Identity:74/332 - (22%)
Similarity:122/332 - (36%) Gaps:58/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 W--ICMRLLVPTF--------FKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPSTAEFFKNL 68
            |  ||..|.|.:|        .::.....||...|..:||.|.....:.|.|.|...    ||.|
  Fly    33 WRSICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYKD----FKFL 93

  Fly    69 TMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCH-ARRFTRCLYIS 132
            .....||   |:...|......||..||   :.|.||::.        :.:|. ....:.||...
  Fly    94 IGQFYCV---LQTETHTAVAEMIVTRES---RRDQFISAM--------YAYCFITAGLSACLMSP 144

  Fly   133 FGMIYALFLFGVFVQVISGNWELL----YPAYFPFDLESNRFLGAVALGY--QVFSMLVEGFQGL 191
            ..|:.:....|          ||.    :|:.:|:|   |..|....:.|  .|.:.|     |:
  Fly   145 LSMLISYQRTG----------ELQPKFPFPSVYPWD---NMKLSNYIISYFWNVCAAL-----GV 191

  Fly   192 GNDTYTPLTL-CLLAGHV-HLWSIRMGQLGYFDD-ETVVNHQRLLDYIEQHKLLVRFHNLVSRTI 253
            ...|....|| |.|:.:: .|:.|...::.:|:. .|...|:.|....:.:.|.:...:.::...
  Fly   192 ALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYF 256

  Fly   254 SEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPY 318
            ..: :.|.......||:: .|.|.......:|::|..|...|..|:...|:..|.:..|.:....
  Fly   257 RPL-ICQFVAASLHLCVL-CYQLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQ 319

  Fly   319 AIFSSRW 325
            ||:.|.|
  Fly   320 AIYESSW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 59/276 (21%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 68/306 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.