DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or88a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:373 Identity:81/373 - (21%)
Similarity:135/373 - (36%) Gaps:103/373 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLD----- 102
            :|::|.:..|:..|......||..:|...     |.                ..|:.|||     
  Fly    86 ITIYFSIRGLMLYLKRKEIVEFVNDLDRE-----CP----------------RDLVSQLDMQMDE 129

  Fly   103 TFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLF---GVFVQV-----ISGNW------ 153
            |:....|.:|:.|.:.|.....|  |:     :..||||.   |....|     :.|.|      
  Fly   130 TYRNFWQRYRFIRIYSHLGGPMF--CV-----VPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVR 187

  Fly   154 --ELLYPAYFPFDLESNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMG 216
              ...|...:.|||.      ....|...|..    |..|.|         ::.||:   .:.:|
  Fly   188 KDPNFYLLVWSFDLM------CTTCGVSFFVT----FDNLFN---------VMQGHL---VMHLG 230

  Fly   217 QLG------------------YFDDETVVNHQRLLDYI-EQHKLLVRFHNLVSRTISEVQLVQLG 262
            .|.                  :.|...:|..|:||:.: .::..:.:...|||..:         
  Fly   231 HLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFV--------- 286

  Fly   263 GCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYD 327
            |.| :||..: :||....|.:.:..|::...|:....|..|...:::.:..|.|..::.|..||.
  Fly   287 GAG-SLCFYL-FMLSETSDVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYL 349

  Fly   328 QSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLF 375
            .||.:|...|::||..  .|...:.|.|||::|:..|...:::||.||
  Fly   350 GSRRYRKFYLLWTQYC--QRTQQLGAFGLIQVNMVHFTEIMQLAYRLF 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 73/351 (21%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 77/368 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.