DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or85d

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:368 Identity:70/368 - (19%)
Similarity:143/368 - (38%) Gaps:74/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHL----PQIVEIESLIEQLDTFIASEQEHR 112
            |:::.|.......|...||:|:.:...:.....::::    .::.::.|.:|:|.....::|| .
  Fly    72 LIYVFLAIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQE-P 135

  Fly   113 YYRDHVHCHARRFTRCLYISFGM----IYALFLFGVFVQVISGNW------ELLYPAY--FPFDL 165
            |...|   |...::|.....|||    |:...|:.....::...|      |.:.|.|  .|:|.
  Fly   136 YNIGH---HLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDW 197

  Fly   166 ESNRFLGAVALGYQVFSMLVE----GFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQ--------L 218
            .:         ||..:.|.:.    |...|.......:.:|.|...|.:..||:..        :
  Fly   198 ST---------GYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHIESHVAGI 253

  Fly   219 GYFDDE------TVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLF 277
            |.|..:      ||..||.|:.              :.:.|:|:..|.|    .:..:..|:::.
  Fly   254 GSFQHDLEFLQATVAYHQSLIH--------------LCQDINEIFGVSL----LSNFVSSSFIIC 300

  Fly   278 FVGDTI-------SLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFD 335
            |||..:       :||..::|.....||:|.....|..:.:..|::..|:::..|:  ..|.|:.
  Fly   301 FVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWF--RADLRYR 363

  Fly   336 LLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
            .::...:....:...:||...:.::|......|:::|..||::
  Fly   364 KMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 65/352 (18%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 65/348 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.