DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or85c

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524280.2 Gene:Or85c / 41008 FlyBaseID:FBgn0037591 Length:389 Species:Drosophila melanogaster


Alignment Length:319 Identity:66/319 - (20%)
Similarity:132/319 - (41%) Gaps:60/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EIESLIEQLDTFI----ASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFL--FGVF------ 145
            ::..|:::|:...    |.|:.:|..|     :.|..:| :.|::.::|::.:  |.:|      
  Fly    92 DLSDLVKELEHIYPNGKAEEEMYRLDR-----YLRSCSR-ISITYALLYSVLIWTFNLFSIMQFL 150

  Fly   146 -------VQVISGNWELLYPAYFPFDLESNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCL 203
                   ::|:...  |.|..|||::...| :...|.|..|.|:    |.........|.|.||.
  Fly   151 VYEKLLKIRVVGQT--LPYLMYFPWNWHEN-WTYYVLLFCQNFA----GHTSASGQISTDLLLCA 208

  Fly   204 LAGHVHLWSIRMGQLGYFDDETVVNHQRLL--DYIEQHKLL---VRFHNLVSRTISEVQLVQLGG 263
            :|..|.:         :||....|..:::|  |:.|..:.|   |::|..:.|.:.  .|..:.|
  Fly   209 VATQVVM---------HFDYLARVVEKQVLDRDWSENSRFLAKTVQYHQRILRLMD--VLNDIFG 262

  Fly   264 CGATLCIIVS-YMLFFVG--------DTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYA 319
            ....|..:|| :::.|||        ..|.:..:|..|..:. |::..|::...:|:....|..:
  Fly   263 IPLLLNFMVSTFVICFVGFQMTVGVPPDIMIKLFLFLFSSLS-QVYLICHYGQLIADASSSLSIS 326

  Fly   320 IFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
            .:...|  |:.|.|:...:...:....|...:||...:.:........|:::|..||::
  Fly   327 AYKQNW--QNADIRYRRALVFFIARPQRTTYLKATIFMNITRATMTDLLQVSYKFFALL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 63/311 (20%)
Or85cNP_524280.2 7tm_6 63..377 CDD:251636 63/311 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.