DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Orco

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:165 Identity:36/165 - (21%)
Similarity:61/165 - (36%) Gaps:36/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 YIEQHKLLVR--------------FHNLVSR---TISEVQLVQLGGCGATLCIIVSYMLFFVGDT 282
            ::|:||.:||              .|.|.|.   |:...|..::.|.......:|.|:       
  Fly   341 WVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGYL------- 398

  Fly   283 ISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNR 347
                      |....|:|..|.|.:.:.||...:..|.:|..|||.|.:.:..:.|..|..  .:
  Fly   399 ----------GYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQC--QK 451

  Fly   348 GWIIKAGGLIELNLNAFFATLKMAYSLFAVVVRAK 382
            ...|.......::|:.|.:.|....:.|.|:|:.|
  Fly   452 AMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 32/153 (21%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.