DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or71a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:372 Identity:90/372 - (24%)
Similarity:158/372 - (42%) Gaps:59/372 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QLYVVLLHILVTLWFPLHLLLHLLL---LPSTAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEI 94
            |.|.  ||:..|..|.|.|.|..:.   :..||:.   |.:.||..|...| |.:::....:.  
  Fly    37 QAYA--LHVPFTFLFVLLLWLEAIKSRDIQHTADV---LLICLTTTALGGK-VINIWKYAHVA-- 93

  Fly    95 ESLIEQLDTF----IASEQEHRYYR-DHVHCHARRFTRCLYISFGMIYALFLFGV--FVQVISGN 152
            :.::.:..|:    :.|:||...:| :|     |||.|..     |.|.|...||  |: ||...
  Fly    94 QGILSEWSTWDLFELRSKQEVDMWRFEH-----RRFNRVF-----MFYCLCSAGVIPFI-VIQPL 147

  Fly   153 WE----LLYPAYFPFDLESNRFLGAVALGYQVFSMLVEGFQGLGNDTYT-----PLTLCLLAGHV 208
            ::    |.:..:.|||.: ...|...|..||..::.:.....:..|...     .|:|||     
  Fly   148 FDIPNRLPFWMWTPFDWQ-QPVLFWYAFIYQATTIPIACACNVTMDAVNWYLMLHLSLCL----- 206

  Fly   209 HLWSIRMGQLGYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIV- 272
            .:...|:.:|.: ||:.:  .::.|:.|..|:.|.:....:...||:....|:......:|..: 
  Fly   207 RMLGQRLSKLQH-DDKDL--REKFLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIY 268

  Fly   273 ----SYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQS-RDH 332
                |.:|..:....:::.|||  .::...:.|:.| .:.|.:....|..::::|.|.|.: |..
  Fly   269 SMQMSPVLQDLPGFAAMMQYLV--AMIMQVMLPTIY-GNAVIDSANMLTDSMYNSDWPDMNCRMR 330

  Fly   333 RFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVVV 379
            |..|:....|   ||...:||||...:.|..|..|:..||||.|:::
  Fly   331 RLVLMFMVYL---NRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 76/333 (23%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 74/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.